CacheBy
Atlas Antibodies Anti-DGUOK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DGUOK Antibody

상품 한눈에 보기

Human DGUOK 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 및 WB 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 검증된 반응성을 보이며, 안정적인 PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034766-100 Anti-DGUOK Antibody, deoxyguanosine kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034766-25 Anti-DGUOK Antibody, deoxyguanosine kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DGUOK Antibody

Anti-DGUOK Antibody

Target Information

  • Target Protein: deoxyguanosine kinase
  • Target Gene: DGUOK
  • Alternative Gene Names: dGK

Product Description

Polyclonal antibody against Human DGUOK.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

STFVKLLTKTYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000011617): 77%
  • Mouse (ENSMUSG00000014554): 75%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.