CacheBy
Atlas Antibodies Anti-DENND6A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DENND6A Antibody

상품 한눈에 보기

Human DENND6A 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 PBS 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069725-100 Anti-DENND6A Antibody, DENN/MADD domain containing 6A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069725-25 Anti-DENND6A Antibody, DENN/MADD domain containing 6A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DENND6A Antibody

Anti-DENND6A Antibody

DENN/MADD domain containing 6A

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human DENND6A.

Alternative Gene Names

AFI1A, FAM116A, FLJ34969

Open Datasheet

Target Information

항목 내용
Target Protein DENN/MADD domain containing 6A
Target Gene DENND6A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000011636 (96%)
Mouse ENSMUSG00000040818 (92%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.