Atlas Antibodies Anti-DENND5A Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA052923-100 | - | Atlas Antibodies HPA052923-100 Anti-DENND5A Antibody, DENN/MADD domain containing 5A 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA052923-25 | - | Atlas Antibodies HPA052923-25 Anti-DENND5A Antibody, DENN/MADD domain containing 5A 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-DENND5A Antibody
DENN/MADD domain containing 5A
Recommended Applications
Product Description
Polyclonal Antibody against Human DENND5A
Alternative Gene Names
FLJ22354, FLJ33829, FLJ43455, KIAA1091, RAB6IP1
Target Protein
DENN/MADD domain containing 5A
Target Gene
DENND5A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000035901 (80%)
Rat ENSRNOG00000012206 (80%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|