CacheBy
Atlas Antibodies Anti-DENND6B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DENND6B Antibody

상품 한눈에 보기

Human DENND6B 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종 간 보존성(마우스 95%, 랫트 92%)을 보임. 글리세롤/PBS 완충액에 보존되어 안정적 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021653-100 Anti-DENND6B Antibody, DENN/MADD domain containing 6B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021653-25 Anti-DENND6B Antibody, DENN/MADD domain containing 6B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DENND6B Antibody

Anti-DENND6B Antibody

DENN/MADD domain containing 6B

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human DENND6B.

Alternative Gene Names

AFI1B, FAM116B, MGC33692

Open Datasheet

Target Information

항목 내용
Target Protein DENN/MADD domain containing 6B
Target Gene DENND6B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HILRVGEPKMSGDLPKQVKLKKPSRLKTLDTKPGLYTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALLRRHLLELTQ
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Info Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.