CacheBy
Atlas Antibodies Anti-RTP4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTP4 Antibody

상품 한눈에 보기

Human RTP4 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용한 affinity purification으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며, glycerol/PBS buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA064887-100 Anti-RTP4 Antibody, receptor (chemosensory) transporter protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064887-25 Anti-RTP4 Antibody, receptor (chemosensory) transporter protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTP4 Antibody

Anti-RTP4 Antibody

제품 개요

Polyclonal antibody against Human RTP4 (receptor chemosensory transporter protein 4)

권장 응용 분야

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

제품 설명

이 항체는 Human RTP4 단백질을 인식하는 rabbit polyclonal antibody로, PrEST 항원을 이용해 affinity purification된 고품질 항체입니다.

대체 유전자명

  • IFRG28
  • Z3CXXC4

Open Datasheet (PDF)

타겟 정보

  • Target Protein: receptor (chemosensory) transporter protein 4
  • Target Gene: RTP4
  • Antigen Sequence:
    CSWSQYEMPEFSSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICG

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000028895 48%
Mouse ENSMUSG00000066319 46%

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer 정보

40% glycerol and PBS (pH 7.2). 0.02% sodium azide가 보존제로 첨가되어 있습니다.
Material Safety Data Sheet

주의 사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.