CacheBy
Atlas Antibodies Anti-DCUN1D2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DCUN1D2 Antibody

상품 한눈에 보기

Human DCUN1D2 단백질을 인식하는 폴리클로날 토끼 IgG 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. 인간에 대해 검증되었으며, 높은 종간 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039349-100 Anti-DCUN1D2 Antibody, DCN1, defective in cullin neddylation 1, domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039349-25 Anti-DCUN1D2 Antibody, DCN1, defective in cullin neddylation 1, domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DCUN1D2 Antibody

Anti-DCUN1D2 Antibody

DCN1, defective in cullin neddylation 1, domain containing 2


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human DCUN1D2


Alternative Gene Names

  • C13orf17
  • FLJ10704
  • FLJ20092

Open Datasheet


Target Information

항목 내용
Target Protein DCN1, defective in cullin neddylation 1, domain containing 2
Target Gene DCUN1D2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000038506 (81%)
  • Rat ENSRNOG00000019473 (80%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.