CacheBy
Atlas Antibodies Anti-CYTH4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYTH4 Antibody

상품 한눈에 보기

Human CYTH4 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산되었습니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 40% 글리세롤/PBS 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071573-100 Anti-CYTH4 Antibody, cytohesin 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071573-25 Anti-CYTH4 Antibody, cytohesin 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYTH4 Antibody

Anti-CYTH4 Antibody

Target Information

  • Target Protein: cytohesin 4
  • Target Gene: CYTH4
  • Alternative Gene Names: CYT4, cytohesin-4, PSCD4

이미지 내 텍스트(OCR): Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human CYTH4

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000018008 83%
Rat ENSRNOG00000007679 81%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.