CacheBy
Atlas Antibodies Anti-CYTL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYTL1 Antibody

상품 한눈에 보기

인간 CYTL1 단백질을 인식하는 토끼 폴리클로날 항체. 면역세포 연구 및 단백질 발현 분석에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Mouse, Rat과 78% 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067201-100 Anti-CYTL1 Antibody, cytokine like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067201-25 Anti-CYTL1 Antibody, cytokine like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYTL1 Antibody

Anti-CYTL1 Antibody

Target Protein: cytokine like 1 (CYTL1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human CYTL1.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

C17, C4orf4


Target Information

  • Target Protein: cytokine like 1
  • Target Gene: CYTL1
  • Antigen Sequence:
    Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000062329 (78%)
  • Rat ENSRNOG00000028108 (78%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Applications ICC (Immunocytochemistry)
Datasheet Open Datasheet (PDF)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.