CacheBy
Atlas Antibodies Anti-CYSRT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYSRT1 Antibody

상품 한눈에 보기

Human CYSRT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤/PBS 버퍼에 보존되어 있습니다. Human에 반응하며 Mouse 및 Rat과 교차 반응성이 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021883-100 Anti-CYSRT1 Antibody, cysteine-rich tail protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021883-25 Anti-CYSRT1 Antibody, cysteine-rich tail protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYSRT1 Antibody

Anti-CYSRT1 Antibody

Target: cysteine-rich tail protein 1 (CYSRT1)
Type: Polyclonal Antibody against Human CYSRT1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

This polyclonal antibody is produced in rabbit and targets the human cysteine-rich tail protein 1 (CYSRT1).


Alternative Gene Names

  • C9orf169
  • MGC59937

Open Datasheet


Target Information

항목 내용
Target Protein cysteine-rich tail protein 1
Target Gene CYSRT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKG
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000036731 (76%), Rat ENSRNOG00000010600 (68%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.