CacheBy
Atlas Antibodies Anti-CYB5RL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYB5RL Antibody

상품 한눈에 보기

인간 CYB5RL 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. 토끼에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제되었습니다. 높은 종 간 항원 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042671-100 Anti-CYB5RL Antibody, cytochrome b5 reductase-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042671-25 Anti-CYB5RL Antibody, cytochrome b5 reductase-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYB5RL Antibody

Anti-CYB5RL Antibody

Target: Cytochrome b5 reductase-like
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CYB5RL.


Alternative Gene Names

  • LOC606495

Open Datasheet


Target Information

항목 내용
Target Protein Cytochrome b5 reductase-like
Target Gene CYB5RL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028621 (77%), Rat ENSRNOG00000009148 (76%)

Antigen Sequence:
QLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIARCLLCAGLTEDSYFLF


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.