Atlas Antibodies Anti-CYBB Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-CYBB Antibody는 인간 CYBB 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. IHC 및 WB에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증을 거쳤습니다. Rabbit 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA051227-100 Anti-CYBB Antibody, cytochrome b-245, beta polypeptide 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA051227-25 Anti-CYBB Antibody, cytochrome b-245, beta polypeptide 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CYBB Antibody

Anti-CYBB Antibody

Target Protein: cytochrome b-245, beta polypeptide
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation)
WB (Western Blot)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human CYBB.

Alternative Gene Names

CGD, GP91-PHOX, NOX2

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	cytochrome b-245, beta polypeptide
Target Gene	CYBB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	FNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLA
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000003622 (80%), Mouse ENSMUSG00000015340 (76%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Safety Data	Material Safety Data Sheet