CacheBy
Atlas Antibodies Anti-CYBRD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYBRD1 Antibody

상품 한눈에 보기

인간 CYBRD1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. CYBRD1 단백질 발현을 RNA-seq 데이터와 비교해 정밀 검증한 제품입니다.

카탈로그번호
HPA014757-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014757-100 Anti-CYBRD1 Antibody, cytochrome b reductase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014757-25 Anti-CYBRD1 Antibody, cytochrome b reductase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYBRD1 Antibody

Anti-CYBRD1 Antibody

Target Protein: cytochrome b reductase 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal Validation)

Orthogonal validation:
Protein expression verified by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human CYBRD1.


Alternative Gene Names

CYB561A2, DCYTB, FLJ23462, FRRS3

Open Datasheet


Specifications

항목 내용
Target Protein cytochrome b reductase 1
Target Gene CYBRD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000009620 (57%), Mouse ENSMUSG00000027015 (51%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.