CacheBy
Atlas Antibodies Anti-CYB5R3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYB5R3 Antibody

상품 한눈에 보기

Human CYB5R3를 인식하는 폴리클로날 항체로, IHC·WB·ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 형식이며 PrEST 항원을 이용해 친화 정제됨. Human에 대해 검증된 반응성을 가지며 안정적인 PBS/glycerol 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001566-100 Anti-CYB5R3 Antibody, cytochrome b5 reductase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001566-25 Anti-CYB5R3 Antibody, cytochrome b5 reductase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYB5R3 Antibody

Anti-CYB5R3 Antibody

Target Information

  • Target Protein: cytochrome b5 reductase 3
  • Target Gene: CYB5R3
  • Alternative Gene Names: DIA1

Product Description

Polyclonal Antibody against Human CYB5R3.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000018042 (86%)
  • Rat ENSRNOG00000009592 (86%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.