CacheBy
Atlas Antibodies Anti-CTPS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CTPS2 Antibody

상품 한눈에 보기

Human CTPS2 단백질을 인식하는 고품질 Polyclonal Rabbit IgG 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장. Human 및 Rat 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075930-100 Anti-CTPS2 Antibody, CTP synthase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075930-25 Anti-CTPS2 Antibody, CTP synthase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTPS2 Antibody

Anti-CTPS2 Antibody

제품 개요

Polyclonal Antibody against Human CTP synthase 2 (CTPS2)

권장 응용

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

제품 설명

  • Target Protein: CTP synthase 2
  • Target Gene: CTPS2
  • Clonality: Polyclonal
  • Isotype: IgG
  • Host: Rabbit
  • Purification Method: Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD

Verified Species Reactivity

  • Human
  • Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000031360 86%
Rat ENSRNOG00000004257 86%

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.