CacheBy
Atlas Antibodies Anti-CTNS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CTNS Antibody

상품 한눈에 보기

Human CTNS 단백질을 인식하는 폴리클로날 래빗 항체로, cystinosin 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. 인간에 대한 반응성이 검증됨. ICC 등 다양한 응용 분야에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046947-100 Anti-CTNS Antibody, cystinosin, lysosomal cystine transporter 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046947-25 Anti-CTNS Antibody, cystinosin, lysosomal cystine transporter 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTNS Antibody

Anti-CTNS Antibody

Target Protein: cystinosin, lysosomal cystine transporter
Supplier: Atlas Antibodies


면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다.


Product Description

Polyclonal Antibody against Human CTNS


Alternative Gene Names

CTNS-LSB, PQLC4

Open Datasheet


Target Information

항목 내용
Target Protein cystinosin, lysosomal cystine transporter
Target Gene CTNS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000005949 (96%), Rat ENSRNOG00000028688 (96%)

Antigen Sequence:
FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF


Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.