CacheBy
Atlas Antibodies Anti-RMND5A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RMND5A Antibody

상품 한눈에 보기

Human RMND5A 단백질을 인식하는 고품질 rabbit polyclonal antibody. IHC 및 Western blot에 적합. PrEST 항원을 이용한 affinity purification으로 높은 특이성과 재현성 보장. 다양한 종에서 100% 서열 동일성 확인.

카탈로그번호
HPA046795-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046795-100 Anti-RMND5A Antibody, required for meiotic nuclear division 5 homolog A (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046795-25 Anti-RMND5A Antibody, required for meiotic nuclear division 5 homolog A (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RMND5A Antibody

Anti-RMND5A Antibody

Target: required for meiotic nuclear division 5 homolog A (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human RMND5A.

Alternative Gene Names

FLJ13910, GID2, GID2A, RMD5

Open Datasheet

Target Information

  • Target Protein: required for meiotic nuclear division 5 homolog A (S. cerevisiae)
  • Target Gene: RMND5A
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000028422 (100%)
  • Mouse ENSMUSG00000002222 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.