CacheBy
Atlas Antibodies Anti-RMND1 Antibody
원본

Atlas Antibodies Anti-RMND1 Antibody

상품 한눈에 보기

인간 RMND1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원으로 정제되었습니다. 인간 반응성이 검증되었고, 마우스 및 랫트와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031399-100 Anti-RMND1 Antibody, required for meiotic nuclear division 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031399-25 Anti-RMND1 Antibody, required for meiotic nuclear division 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RMND1 Antibody

Anti-RMND1 Antibody

Target: required for meiotic nuclear division 1 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human RMND1.

Alternative Gene Names

bA351K16.3, C6orf96, FLJ20627, RMD1

Open Datasheet

Target Information

  • Target Protein: required for meiotic nuclear division 1 homolog (S. cerevisiae)
  • Target Gene: RMND1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000019763 84%
Rat ENSRNOG00000019501 82%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.