CacheBy
Atlas Antibodies Anti-RMND1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RMND1 Antibody

상품 한눈에 보기

Human RMND1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며 Mouse 및 Rat과 높은 서열 유사성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031397-100 Anti-RMND1 Antibody, required for meiotic nuclear division 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031397-25 Anti-RMND1 Antibody, required for meiotic nuclear division 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RMND1 Antibody

Anti-RMND1 Antibody

Target Information

  • Target Protein: required for meiotic nuclear division 1 homolog (S. cerevisiae)
  • Target Gene: RMND1
  • Alternative Gene Names: bA351K16.3, C6orf96, FLJ20627, RMD1

Product Description

  • Type: Polyclonal Antibody against Human RMND1
  • Host: Rabbit
  • Isotype: IgG
  • Clonality: Polyclonal
  • Purification Method: Affinity purified using the PrEST antigen as affinity ligand
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000019763 84%
Rat ENSRNOG00000019501 82%

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.