AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RMDN3 Antibody
상품 한눈에 보기
Human RMDN3 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, Rat 및 Mouse와도 높은 서열 유사성을 가집니다.
- 카탈로그번호
- HPA009975-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA009975-100 Anti-RMDN3 Antibody, regulator of microtubule dynamics 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009975-25 Anti-RMDN3 Antibody, regulator of microtubule dynamics 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RMDN3 Antibody
Anti-RMDN3 Antibody
Regulator of microtubule dynamics 3
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human RMDN3.
Alternative Gene Names
FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Regulator of microtubule dynamics 3 |
| Target Gene | RMDN3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG |
Species Reactivity
- Verified Reactivity: Human
- Interspecies Information:
- Rat (84%, ENSRNOG00000049007)
- Mouse (80%, ENSMUSG00000070730)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.