CacheBy
Atlas Antibodies Anti-RBPMS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RBPMS Antibody

상품 한눈에 보기

Human RBPMS 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 직교 검증 완료. 고순도 Affinity 정제 방식 적용. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056999-100 Anti-RBPMS Antibody, RNA binding protein with multiple splicing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056999-25 Anti-RBPMS Antibody, RNA binding protein with multiple splicing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RBPMS Antibody

Anti-RBPMS Antibody

RNA binding protein with multiple splicing

  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human RBPMS

Alternative Gene Names

  • HERMES

Target Information

항목 내용
Target Protein RNA binding protein with multiple splicing
Target Gene RBPMS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PSTPLPNTVPQFIAREPYELTVPALYPSSPEV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000031586 (100%), Rat ENSRNOG00000013328 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.