CacheBy
Atlas Antibodies Anti-RBP7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RBP7 Antibody

상품 한눈에 보기

Human RBP7 단백질을 인식하는 폴리클로날 항체로, IHC 및 Western blot에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증됨. Rabbit 호스트에서 생산, 높은 종간 반응성 보유. PrEST 항원으로 친화 정제된 고품질 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034749-100 Anti-RBP7 Antibody, retinol binding protein 7, cellular 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034749-25 Anti-RBP7 Antibody, retinol binding protein 7, cellular 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RBP7 Antibody

Anti-RBP7 Antibody

Target: Retinol Binding Protein 7, Cellular
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Suitable for detection of RBP7 protein.

Product Description

Polyclonal antibody against human RBP7.


Alternative Gene Names

  • CRBPIV

Target Information

항목 내용
Target Protein Retinol Binding Protein 7, Cellular
Target Gene RBP7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000028996 (85%), Rat ENSRNOG00000015850 (82%)
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK

Additional Resources

Open Datasheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.