
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RBP5 Antibody
상품 한눈에 보기
Human RBP5 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 특이적으로 반응하며, retinol binding protein 5 연구에 활용됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038723-100 Anti-RBP5 Antibody, retinol binding protein 5, cellular 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038723-25 Anti-RBP5 Antibody, retinol binding protein 5, cellular 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RBP5 Antibody
Anti-RBP5 Antibody
Target: retinol binding protein 5, cellular (RBP5)
Type: Polyclonal Antibody against Human RBP5
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated using IHC compared to RNA-seq data in tissues with high and low expression.
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting Human RBP5 (retinol binding protein 5, cellular).
Alternative Gene Names
- CRBPIII
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Retinol binding protein 5, cellular |
| Target Gene | RBP5 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | NYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAV |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000032454 | 60% |
| Rat | ENSRNOG00000013932 | 60% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



