CacheBy
Atlas Antibodies Anti-RBM26 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RBM26 Antibody

상품 한눈에 보기

인간 RBM26 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. siRNA knockdown으로 유전적 검증이 완료되었으며, 토끼 유래 IgG 항체입니다. 고순도의 Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040252-100 Anti-RBM26 Antibody, RNA binding motif protein 26 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040252-25 Anti-RBM26 Antibody, RNA binding motif protein 26 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RBM26 Antibody

Anti-RBM26 Antibody

Target Protein: RNA binding motif protein 26
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RBM26.


Alternative Gene Names

ARRS2, C13orf10, FLJ20957, PPP1R132, PRO1777, SE70-2, ZC3H17

Open Datasheet


Specifications

항목 내용
Target Protein RNA binding motif protein 26
Target Gene RBM26
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PPLTPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGY
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000009836 (98%), Mouse ENSMUSG00000022119 (98%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative.
Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.