Atlas Antibodies Anti-RBM28 Antibody

상품 한눈에 보기

인간 RBM28 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도 IgG 형태로 제공됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019058-100 Anti-RBM28 Antibody, RNA binding motif protein 28 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019058-25 Anti-RBM28 Antibody, RNA binding motif protein 28 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

RNA binding motif protein 28

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Polyclonal Antibody against Human RBM28

항목	내용
Target Protein	RNA binding motif protein 28
Target Gene	RBM28
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQSLGYAFAEFQEHEHALKALRLINNNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQRSLQKMRSKPATGEPQKGQPEPAKDQQQK

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand