CacheBy
Atlas Antibodies Anti-RBM20 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RBM20 Antibody

상품 한눈에 보기

Human RBM20 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 버퍼에 보존되어 안정적인 연구용 시약입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037703-100 Anti-RBM20 Antibody, RNA binding motif protein 20 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037703-25 Anti-RBM20 Antibody, RNA binding motif protein 20 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RBM20 Antibody

Anti-RBM20 Antibody

Target Information

  • Target Protein: RNA binding motif protein 20
  • Target Gene: RBM20
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
ADWGNGRDSWEHSPYARREEERDPAPWRDNGDDKRDRMDPWAHDRKHHPRQLDKAELDERPEGGRPHREKYPRSGSPNLPHSVSSYKSRED

Product Description

Polyclonal antibody against Human RBM20.

Open Datasheet

  • Immunohistochemistry (IHC)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000043639): 70%
  • Rat (ENSRNOG00000014705): 69%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Application - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.