CacheBy
Atlas Antibodies Anti-RAB3D Antibody
원본

Atlas Antibodies Anti-RAB3D Antibody

상품 한눈에 보기

Human RAB3D 단백질을 인식하는 폴리클로날 항체로, Rabbit 호스트에서 생산된 IgG 타입입니다. Affinity purification으로 높은 특이성과 순도를 보장하며, ICC 등 다양한 응용에 적합합니다. Human, Mouse, Rat 종에서 반응성이 검증되었습니다.

카탈로그번호
HPA063283-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063283-100 Anti-RAB3D Antibody, RAB3D, member RAS oncogene family 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063283-25 Anti-RAB3D Antibody, RAB3D, member RAS oncogene family 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAB3D Antibody

Anti-RAB3D Antibody

Target: RAB3D, member of the RAS oncogene family
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human RAB3D.


Alternative Gene Names

D2-2, GOV, RAB16, RAD3D

Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: CEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000019066 86%
Rat ENSRNOG00000011582 83%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.