CacheBy
Atlas Antibodies Anti-RAB3GAP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAB3GAP2 Antibody

상품 한눈에 보기

Human RAB3GAP2 단백질을 인식하는 폴리클로날 래빗 항체로, IHC 및 ICC 적용에 적합. 고순도 Affinity 정제 방식으로 높은 특이성과 재현성을 제공. 인간, 랫, 마우스 종 간 99% 서열 동일성 확인. 안정적 PBS/glycerol buffer 포뮬레이션.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026273-100 Anti-RAB3GAP2 Antibody, RAB3 GTPase activating protein subunit 2 (non-catalytic) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026273-25 Anti-RAB3GAP2 Antibody, RAB3 GTPase activating protein subunit 2 (non-catalytic) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAB3GAP2 Antibody

Anti-RAB3GAP2 Antibody

RAB3 GTPase activating protein subunit 2 (non-catalytic)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human RAB3GAP2

Alternative Gene Names

DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69

Open Datasheet

Target Information

항목 내용
Target Protein RAB3 GTPase activating protein subunit 2 (non-catalytic)
Target Gene RAB3GAP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000002353 (99%), Mouse ENSMUSG00000039318 (99%)

Antigen Sequence:

TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.