CacheBy
Atlas Antibodies Anti-RAB3GAP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAB3GAP2 Antibody

상품 한눈에 보기

인간 RAB3GAP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 PBS 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027299-100 Anti-RAB3GAP2 Antibody, RAB3 GTPase activating protein subunit 2 (non-catalytic) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027299-25 Anti-RAB3GAP2 Antibody, RAB3 GTPase activating protein subunit 2 (non-catalytic) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAB3GAP2 Antibody

Anti-RAB3GAP2 Antibody

RAB3 GTPase activating protein subunit 2 (non-catalytic)


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RAB3GAP2.


Alternative Gene Names

DKFZP434D245, KIAA0839, RAB3-GAP150, SPG69

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein RAB3 GTPase activating protein subunit 2 (non-catalytic)
Target Gene RAB3GAP2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA

Species Reactivity

  • Verified: Human
  • Interspecies Information:
    • Rat ENSRNOG00000002353 (99%)
    • Mouse ENSMUSG00000039318 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.