Atlas Antibodies Anti-RAB27B Antibody

상품 한눈에 보기

인간 RAB27B 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 인간 반응성 확인 및 마우스·랫트 교차 반응 정보 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019849-100 Anti-RAB27B Antibody, RAB27B, member RAS oncogene family 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019849-25 Anti-RAB27B Antibody, RAB27B, member RAS oncogene family 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: RAB27B, member of RAS oncogene family
Supplier: Atlas Antibodies

IHC (Orthogonal Validation): Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression): Validation in Western blot (WB) using target protein overexpression.

Polyclonal antibody against human RAB27B.
Affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	RAB27B, member RAS oncogene family
Target Gene	RAB27B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000024511 (90%), Rat ENSRNOG00000012176 (86%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.