
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RAB27A Antibody
상품 한눈에 보기
인간 RAB27A 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. 고순도의 Affinity 정제 항체로 다양한 연구 응용에 적합. 인간 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001333-100 Anti-RAB27A Antibody, RAB27A, member RAS oncogene family 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001333-25 Anti-RAB27A Antibody, RAB27A, member RAS oncogene family 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RAB27A Antibody
Anti-RAB27A Antibody
Target: RAB27A, member RAS oncogene family
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against human RAB27A.
Alternative Gene Names
GS2, HsT18676, RAB27, RAM
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | RAB27A, member RAS oncogene family |
| Target Gene | RAB27A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000052499 (97%), Mouse ENSMUSG00000032202 (96%) |
Antigen Sequence:
LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



