CacheBy
Atlas Antibodies Anti-RAB27A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAB27A Antibody

상품 한눈에 보기

인간 RAB27A 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. 고순도의 Affinity 정제 항체로 다양한 연구 응용에 적합. 인간 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001333-100 Anti-RAB27A Antibody, RAB27A, member RAS oncogene family 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001333-25 Anti-RAB27A Antibody, RAB27A, member RAS oncogene family 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAB27A Antibody

Anti-RAB27A Antibody

Target: RAB27A, member RAS oncogene family
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human RAB27A.


Alternative Gene Names

GS2, HsT18676, RAB27, RAM


Target Information

항목 내용
Target Protein RAB27A, member RAS oncogene family
Target Gene RAB27A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000052499 (97%), Mouse ENSMUSG00000032202 (96%)

Antigen Sequence:
LQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLS


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.