Atlas Antibodies Anti-RAB23 Antibody

상품 한눈에 보기

Human RAB23 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Recombinant expression으로 검증되었으며, 고순도 Affinity 정제 방식으로 제조되었습니다. Human에 반응하며, 40% glycerol 기반 buffer로 안정화되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029135-100 Anti-RAB23 Antibody, RAB23, member RAS oncogene family 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029135-25 Anti-RAB23 Antibody, RAB23, member RAS oncogene family 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RAB23 Antibody

Anti-RAB23 Antibody

제품 개요

Polyclonal Antibody against Human RAB23, member of the RAS oncogene family.

권장 응용

IHC (Immunohistochemistry)
WB (Western Blot) – Recombinant expression validation using target protein overexpression
ICC (Immunocytochemistry)

제품 설명

이 항체는 Human RAB23 단백질을 인식하는 Rabbit Polyclonal Antibody입니다. Recombinant Protein Epitope Signature Tag (PrEST) 항원을 이용해 제작되었습니다.

Open Datasheet

타깃 정보

항목	내용
Target Protein	RAB23, member RAS oncogene family
Target Gene	RAB23
Antigen Sequence	GAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYR
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000004768 (96%), Rat ENSRNOG00000012629 (96%)

항체 특성

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

보관 및 취급

항목	내용
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet
주의사항	사용 전 부드럽게 혼합하십시오. 각 응용에 따른 최적 조건은 사용자가 직접 결정해야 합니다.