AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-QRFPR Antibody
상품 한눈에 보기
인간 QRFPR 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 정제되었습니다. 인간에 대한 반응성이 검증되어 있으며, GPR103 유전자 대체명으로도 알려져 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050236-100 Anti-QRFPR Antibody, pyroglutamylated RFamide peptide receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050236-25 Anti-QRFPR Antibody, pyroglutamylated RFamide peptide receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-QRFPR Antibody
Anti-QRFPR Antibody
Target Information
- Protein: Pyroglutamylated RFamide peptide receptor
- Gene: QRFPR
- Alternative Gene Names: GPR103
Recommended Applications
IHC (Immunohistochemistry)
Product Description
Polyclonal antibody against human QRFPR.
Antigen Information
- Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000058400 | 85% |
| Rat | ENSRNOG00000014414 | 83% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.