Atlas Antibodies Anti-QARS Antibody

상품 한눈에 보기

Human QARS(glutaminyl-tRNA synthetase)을 타깃으로 하는 Rabbit Polyclonal Antibody. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교로 검증된 신뢰성 높은 품질. Affinity purification 방식으로 높은 특이도와 재현성 제공.

카탈로그번호: HPA036987-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036987-100 Anti-QARS Antibody, glutaminyl-tRNA synthetase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036987-25 Anti-QARS Antibody, glutaminyl-tRNA synthetase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-QARS Antibody

Anti-QARS Antibody

Target: glutaminyl-tRNA synthetase

Recommended Applications

IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human QARS

Open Datasheet

Target Information

항목	내용
Target Protein	glutaminyl-tRNA synthetase
Target Gene	QARS
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (AA)	HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000054139 (100%), Mouse ENSMUSG00000032604 (85%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand