CacheBy
Atlas Antibodies Anti-QARS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-QARS Antibody

상품 한눈에 보기

Human QARS(glutaminyl-tRNA synthetase)을 인식하는 Rabbit Polyclonal 항체. IHC, WB, ICC에 적합하며 독립 항체 간 비교로 검증됨. Human, Mouse, Rat 반응성 확인. PrEST 항원을 이용해 친화 정제된 고품질 항체.

카탈로그번호
HPA036986-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036986-100 Anti-QARS Antibody, glutaminyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036986-25 Anti-QARS Antibody, glutaminyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-QARS Antibody

Anti-QARS Antibody

Target: glutaminyl-tRNA synthetase


  • IHC (Immunohistochemistry) – Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot) – Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human QARS
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein glutaminyl-tRNA synthetase
Target Gene QARS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFIHWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDA

Species Reactivity

Verified Species Human, Mouse, Rat
Interspecies Information Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000054139 (100%)
Mouse ENSMUSG00000032604 (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.