CacheBy
Atlas Antibodies Anti-PTPRN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2
Atlas Antibodies

Atlas Antibodies Anti-PTPRN Antibody

상품 한눈에 보기

Human PTPRN 단백질을 인식하는 Rabbit Polyclonal 항체로, IA-2로도 알려진 표적 단백질 검출에 적합합니다. Affinity purification 방식으로 제조되었으며, ICC 등 다양한 응용에 활용 가능합니다. Human에 대해 검증된 반응성을 가집니다.

카탈로그번호
HPA007152-xxx (2개 옵션)
브랜드
Atlas Antibodies
카테고리
Polyclonal Antibodies
판매단위
100ul, 25ul
#Antibodies#Atlas Antibodies

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007152-100 Anti-PTPRN Antibody, protein tyrosine phosphatase, receptor type, N 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007152-25 Anti-PTPRN Antibody, protein tyrosine phosphatase, receptor type, N 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PTPRN Antibody

Anti-PTPRN Antibody

Target: Protein tyrosine phosphatase, receptor type, N (PTPRN)
Alternative Gene Name: IA-2
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PTPRN (IA-2).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Target Information

항목 내용
Target Protein Protein tyrosine phosphatase, receptor type, N
Target Gene PTPRN
Alternative Gene Name IA-2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000019587 (81%)
  • Mouse ENSMUSG00000026204 (77%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Information

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기
Atlas AntibodiesAtlas Antibodies Anti-PTPRN Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-PTPRN2 Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-PTPRM Antibody528,000원VAT별도
Atlas AntibodiesAtlas Antibodies Anti-PTPRK Antibody528,000원VAT별도

문의

0개
로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.