CacheBy
Atlas Antibodies Anti-PTPRK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTPRK Antibody

상품 한눈에 보기

Human PTPRK 단백질에 대한 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이도 확보. ICC 등 다양한 응용에 적합하며, 안정적 보존을 위한 glycerol 및 PBS buffer 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054822-100 Anti-PTPRK Antibody, protein tyrosine phosphatase, receptor type, K 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054822-25 Anti-PTPRK Antibody, protein tyrosine phosphatase, receptor type, K 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTPRK Antibody

Anti-PTPRK Antibody

Target: Protein tyrosine phosphatase, receptor type, K (PTPRK)
Supplier: Atlas Antibodies


면역세포화학(ICC) 등 다양한 연구 응용에 적합

Product Description

Polyclonal antibody against human PTPRK.

Alternative Gene Names

  • R-PTP-kappa

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Protein tyrosine phosphatase, receptor type, K
Target Gene PTPRK
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human

Antigen Sequence:
QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTM


Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 실험 목적에 따라 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.