Atlas Antibodies Anti-PTPRN Antibody

상품 한눈에 보기

Human PTPRN 단백질을 인식하는 Rabbit Polyclonal 항체로, IA-2로도 알려진 표적 단백질을 검출. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 40% glycerol/PBS buffer에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007179-100 Anti-PTPRN Antibody, protein tyrosine phosphatase, receptor type, N 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007179-25 Anti-PTPRN Antibody, protein tyrosine phosphatase, receptor type, N 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: protein tyrosine phosphatase, receptor type, N (PTPRN)
Alternative Gene Name: IA-2
Supplier: Atlas Antibodies

Polyclonal antibody against human PTPRN (IA-2).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	protein tyrosine phosphatase, receptor type, N
Target Gene	PTPRN
Alternative Gene Name	IA-2
Verified Species Reactivity	Human
Interspecies Identity	Rat (81%), Mouse (77%)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety	Material Safety Data Sheet