CacheBy
Atlas Antibodies Anti-PTPRK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTPRK Antibody

상품 한눈에 보기

인간 PTPRK 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산됨. Affinity 정제 방식으로 높은 특이도와 재현성을 제공. 면역형광(ICC) 등 다양한 연구 응용에 적합. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054056-100 Anti-PTPRK Antibody, protein tyrosine phosphatase, receptor type, K 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054056-25 Anti-PTPRK Antibody, protein tyrosine phosphatase, receptor type, K 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTPRK Antibody

Anti-PTPRK Antibody

Target: protein tyrosine phosphatase, receptor type, K
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PTPRK (protein tyrosine phosphatase, receptor type, K).


Alternative Gene Names

  • R-PTP-kappa

Open Datasheet


Target Information

항목 내용
Target Protein protein tyrosine phosphatase, receptor type, K
Target Gene PTPRK
Verified Species Reactivity Human

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence QFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTM

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.