AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PTPN5 Antibody
상품 한눈에 보기
Human PTPN5 단백질에 특이적인 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 적합하며, 보존용으로 glycerol과 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031014-100 Anti-PTPN5 Antibody, protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031014-25 Anti-PTPN5 Antibody, protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PTPN5 Antibody
Anti-PTPN5 Antibody
Target: protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human PTPN5.
Alternative Gene Names
- PTPSTEP
- STEP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) |
| Target Gene | PTPN5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000013981 (97%), Mouse ENSMUSG00000030854 (94%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.