CacheBy
Atlas Antibodies Anti-PTPN7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTPN7 Antibody

상품 한눈에 보기

Human PTPN7 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer로 제공됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019118-100 Anti-PTPN7 Antibody, protein tyrosine phosphatase, non-receptor type 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019118-25 Anti-PTPN7 Antibody, protein tyrosine phosphatase, non-receptor type 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTPN7 Antibody

Anti-PTPN7 Antibody

Protein tyrosine phosphatase, non-receptor type 7 (PTPN7)

면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.

Product Description

Polyclonal antibody against human PTPN7.

Alternative Gene Names

HEPTP, LC-PTP

Open Datasheet

Target Information

항목 내용
Target Protein Protein tyrosine phosphatase, non-receptor type 7
Target Gene PTPN7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000031506 (93%), Rat ENSRNOG00000005807 (92%)

Antigen Sequence

LIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.