CacheBy
Atlas Antibodies Anti-PTPN12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTPN12 Antibody

상품 한눈에 보기

Human PTPN12 단백질에 대한 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human에 특이적으로 반응하며, 안정적인 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA007097-100 Anti-PTPN12 Antibody, protein tyrosine phosphatase, non-receptor type 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007097-25 Anti-PTPN12 Antibody, protein tyrosine phosphatase, non-receptor type 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTPN12 Antibody

Anti-PTPN12 Antibody

Protein Tyrosine Phosphatase, Non-Receptor Type 12

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PTPN12.

Alternative Gene Names

  • PTP-PEST
  • PTPG1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Protein tyrosine phosphatase, non-receptor type 12
Target Gene PTPN12
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000013135 (64%)
Mouse ENSMUSG00000028771 (63%)

Antigen Sequence

SVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNPLHSDDSDSDERNSDGAVTQNKTNISTASATVSAAT

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.