Atlas Antibodies Anti-PTH1R Antibody

상품 한눈에 보기

사람 PTH1R 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. Human에 반응하며, 안정한 보관을 위해 글리세롤과 PBS 완충액에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA075879-100 Anti-PTH1R Antibody, parathyroid hormone 1 receptor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA075879-25 Anti-PTH1R Antibody, parathyroid hormone 1 receptor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human PTH1R, generated in rabbit.

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence:
RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ

Verified Species: Human
Interspecies Identity:
- Mouse (ENSMUSG00000032492): 86%
- Rat (ENSRNOG00000020948): 86%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.