
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PTH1R Antibody
상품 한눈에 보기
사람 PTH1R 단백질을 인식하는 폴리클로날 항체로, 면역조직화학 등 다양한 연구용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. Human에 반응하며, 안정한 보관을 위해 글리세롤과 PBS 완충액에 보존됩니다.
- 카탈로그번호
- HPA075879-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA075879-100 Anti-PTH1R Antibody, parathyroid hormone 1 receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075879-25 Anti-PTH1R Antibody, parathyroid hormone 1 receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PTH1R Antibody
Anti-PTH1R Antibody
Target Information
- Target Protein: Parathyroid hormone 1 receptor
- Target Gene: PTH1R
- Alternative Gene Names: PTHR, PTHR1
Product Description
Polyclonal antibody against human PTH1R, generated in rabbit.
Recommended Applications
- Immunohistochemistry (IHC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQ
Species Reactivity
- Verified Species: Human
- Interspecies Identity:
- Mouse (ENSMUSG00000032492): 86%
- Rat (ENSRNOG00000020948): 86%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Storage Note | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



