Atlas Antibodies Anti-PTGS1 Antibody

상품 한눈에 보기

Human PTGS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 적합합니다. 정제된 PrEST 항원 기반 친화정제 제품이며, 인간 시료에 검증되었습니다. COX1/PGHS-1 대체명으로 알려진 단백질 연구에 활용 가능합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA002834-100 Anti-PTGS1 Antibody, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA002834-25 Anti-PTGS1 Antibody, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PTGS1 Antibody

Anti-PTGS1 Antibody

Target: prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)

Recommended Applications

IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서의 발현을 검증
WB (Western Blot)
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human PTGS1

Alternative Gene Names

COX1, PGHS-1, PTGHS

Open Datasheet

Target Information

항목	내용
Target Protein	prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Target Gene	PTGS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000047250 (93%), Rat ENSRNOG00000007415 (90%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)