CacheBy
Atlas Antibodies Anti-PTGS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTGS1 Antibody

상품 한눈에 보기

Human PTGS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 적합합니다. 정제된 PrEST 항원 기반 친화정제 제품이며, 인간 시료에 검증되었습니다. COX1/PGHS-1 대체명으로 알려진 단백질 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA002834-100 Anti-PTGS1 Antibody, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002834-25 Anti-PTGS1 Antibody, prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTGS1 Antibody

Anti-PTGS1 Antibody

Target: prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)


  • IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서의 발현을 검증
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human PTGS1


Alternative Gene Names

COX1, PGHS-1, PTGHS

Open Datasheet


Target Information

항목 내용
Target Protein prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
Target Gene PTGS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGN
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000047250 (93%), Rat ENSRNOG00000007415 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.