Atlas Antibodies Anti-PTGS2 Antibody

상품 한눈에 보기

인간 PTGS2(COX2) 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 40% 글리세롤과 PBS 완충액에 보존됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001335-100 Anti-PTGS2 Antibody, prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001335-25 Anti-PTGS2 Antibody, prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PTGS2 Antibody

Anti-PTGS2 Antibody

Target Information

Target Protein: prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Target Gene: PTGS2
Alternative Gene Names: COX2

Product Description

Polyclonal antibody against human PTGS2.

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE