CacheBy
Atlas Antibodies Anti-PTGS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTGS2 Antibody

상품 한눈에 보기

인간 PTGS2(COX2) 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 40% 글리세롤과 PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA001335-100 Anti-PTGS2 Antibody, prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001335-25 Anti-PTGS2 Antibody, prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTGS2 Antibody

Anti-PTGS2 Antibody

Target Information

  • Target Protein: prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
  • Target Gene: PTGS2
  • Alternative Gene Names: COX2

Product Description

Polyclonal antibody against human PTGS2.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    RQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEALYGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000002525 88%
Mouse ENSMUSG00000032487 88%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.