원본

Atlas Antibodies Anti-CRLF1 Antibody

상품 한눈에 보기

Human CRLF1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 고순도의 IgG 형태로 제공됨. 40% glycerol 기반 PBS buffer에 sodium azide 보존제가 포함됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041793-100 Anti-CRLF1 Antibody, cytokine receptor-like factor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041793-25 Anti-CRLF1 Antibody, cytokine receptor-like factor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CRLF1 Antibody

Anti-CRLF1 Antibody

Target Information

Target Protein: Cytokine receptor-like factor 1 (CRLF1)
Alternative Gene Names: CISS, CISS1, CLF, CLF-1
Target Gene: CRLF1

Product Description

Polyclonal antibody against human CRLF1, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand. Suitable for immunohistochemistry and other antibody-based assays.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat: ENSRNOG00000020030 (93%)
Mouse: ENSMUSG00000007888 (93%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	Immunohistochemistry (IHC)
Storage & Handling	Gently mix before use. Optimal concentrations and conditions should be determined by the user.