Atlas Antibodies Anti-CRLF3 Antibody

상품 한눈에 보기

인간 CRLF3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증된 고품질 제품입니다. Orthogonal 및 Genetic validation을 통해 신뢰성 확보. Rabbit 유래 IgG 항체로 PrEST 항원 기반 친화 정제. Human에 반응하며 높은 종간 보존성을 가집니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007596-100 Anti-CRLF3 Antibody, cytokine receptor-like factor 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007596-25 Anti-CRLF3 Antibody, cytokine receptor-like factor 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CRLF3 Antibody

Anti-CRLF3 Antibody

Target: Cytokine receptor-like factor 3 (CRLF3)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation (IHC):
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation (WB):
Genetic validation in WB by siRNA knockdown.
ICC:
Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human CRLF3

Alternative Gene Names

CREME9, CYTOR4

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	Cytokine receptor-like factor 3
Target Gene	CRLF3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	IEHGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTSNHFEDVYVGSE
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000017561 (94%), Rat ENSRNOG00000050657 (89%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.