Atlas Antibodies Anti-CRLF1 Antibody

상품 한눈에 보기

Human CRLF1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 안정화 용액(PBS, glycerol, sodium azide) 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA041493-100 Anti-CRLF1 Antibody, cytokine receptor-like factor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA041493-25 Anti-CRLF1 Antibody, cytokine receptor-like factor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Cytokine receptor-like factor 1 (CRLF1)
Supplier: Atlas Antibodies

Polyclonal antibody against human CRLF1.

CISS, CISS1, CLF, CLF-1

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLP

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000020030	93%
Mouse	ENSMUSG00000007888	93%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.