CacheBy
Atlas Antibodies Anti-CRHBP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRHBP Antibody

상품 한눈에 보기

인간 CRHBP 단백질을 인식하는 폴리클로날 항체로, WB 등 다양한 응용에 적합. Rabbit에서 제조되었으며 IgG 아이소타입. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 반응하며 Mouse, Rat과도 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046120-100 Anti-CRHBP Antibody, corticotropin releasing hormone binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046120-25 Anti-CRHBP Antibody, corticotropin releasing hormone binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRHBP Antibody

Anti-CRHBP Antibody

Target: Corticotropin Releasing Hormone Binding Protein (CRHBP)
Supplier: Atlas Antibodies

  • Western Blot (WB)

Product Description

Polyclonal antibody against human CRHBP.

Alternative Gene Names

  • CRF-BP
  • CRFBP

Open Datasheet

Target Information

항목 내용
Target Protein Corticotropin Releasing Hormone Binding Protein
Target Gene CRHBP
Verified Species Reactivity Human
Interspecies Identity Mouse (84%), Rat (81%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application: WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.