CacheBy
Atlas Antibodies Anti-CPNE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPNE1 Antibody

상품 한눈에 보기

Human CPNE1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 실험에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현을 비교 검증하였습니다. 고순도 Affinity 정제 방식으로 제조되어 신뢰성 높은 결과를 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047259-100 Anti-CPNE1 Antibody, copine I 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047259-25 Anti-CPNE1 Antibody, copine I 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPNE1 Antibody

Anti-CPNE1 Antibody

Target Protein: copine I


  • WB (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression cell lines
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human CPNE1


Alternative Gene Names

  • CPN1

Open Datasheet


Target Information

항목 내용
Target Protein copine I
Target Gene CPNE1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000074643 (87%), Rat ENSRNOG00000046990 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.