Atlas Antibodies Anti-CPNE1 Antibody

상품 한눈에 보기

Human CPNE1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. WB 및 ICC 응용에 적합하며, Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Affinity purification 방식으로 고순도 확보.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA072634-100 Anti-CPNE1 Antibody, copine I 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA072634-25 Anti-CPNE1 Antibody, copine I 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CPNE1 Antibody

Anti-CPNE1 Antibody

Target Protein: copine I
Supplier: Atlas Antibodies

Recommended Applications

WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human CPNE1

Alternative Gene Names

CPN1

Open Datasheet

Specifications

항목	내용
Target Protein	copine I
Target Gene	CPNE1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGS
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000074643 (87%), Rat ENSRNOG00000046990 (85%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand